PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21155A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family HD-ZIP
Protein Properties Length: 638aa    MW: 68147.2 Da    PI: 6.451
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21155AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.83.4e-22101156156
                                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                r++ +++t++q++eLe lF+++++p++++r eL+k+lgL+ rqVk+WFqNrR+++k
  Oropetium_20150105_21155A 101 RKRYHRHTPQQIQELEGLFKECPHPDEKQRGELSKRLGLDPRQVKFWFQNRRTQMK 156
                                688899***********************************************999 PP

2START782.4e-25297378138206
                                .-TTSEE-EESSEEEEEEEECTCE.............EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                      START 138 esssvvRaellpSgiliepksngh.............skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                ++++ v++++lpSg+li++++ng+             s vtwveh++++++++h+l+r+l++sgla+ga++w+atlqrqce+
  Oropetium_20150105_21155A 297 STAGNVKCRRLPSGCLIQDTPNGYcqsslvaslalrqSHVTWVEHTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCEC 378
                                37899***************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-2386158IPR009057Homeodomain-like
SuperFamilySSF466891.75E-2189158IPR009057Homeodomain-like
PROSITE profilePS5007118.20498158IPR001356Homeobox domain
SMARTSM003891.0E-2099162IPR001356Homeobox domain
PfamPF000461.1E-19101156IPR001356Homeobox domain
CDDcd000863.52E-18108158No hitNo description
PROSITE patternPS000270133156IPR017970Homeobox, conserved site
PfamPF018525.7E-21297378IPR002913START domain
SuperFamilySSF559612.2E-8298378No hitNo description
PROSITE profilePS5084817.154302381IPR002913START domain
SuperFamilySSF559616.32E-21397610No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MSFGSLFDGG AGGSGGGMQF PYSTAGFSSS PALSLGLDNA AGGMGIAGFM HPGGLGADGA  60
MGRDADPEND SRSGSDHLDA LSGGGEDEDE AEPSNNSRKR RKRYHRHTPQ QIQELEGLFK  120
ECPHPDEKQR GELSKRLGLD PRQVKFWFQN RRTQMKTQLE RHENALLKQE NDKLRAENMT  180
IREAMRSPMC GGCGSPAMLG EVSLEEQHLR IENARLKDEL NRVYALASKF LGKPMSFLTG  240
PQLQPHLSLP MPGSSLELGV GGLGGMGPMA PATMPGTMGD FAGGVSSPMG TNSATTSTAG  300
NVKCRRLPSG CLIQDTPNGY CQSSLVASLA LRQSHVTWVE HTEYDEASVH QLYRPLLRSG  360
LAFGARRWLA TLQRQCECLA ILMSPDTVSA NDSSVITPEG KRNMLKLARR MTENFCAGVS  420
ASSAREWSKL DFAAGCIGED VRVMARKSVN DPGEPPGVVL SAATSVWMPV APEKLFNFLR  480
NEQLRAEWDI LSNGAPMQEM ANIAKGQQGH GNSVSLLRVN AISANQSSML ILQETCTDAS  540
GSMVVYAPVD IPAMQLVMNG GDSTYVALLP SGFAILPDGP SMDSAEHKTG GSLLTVAFQI  600
LVNSQPTAKL TVESVDTVNN LISCTIKKIK SALQGDT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632490.0BT063249.1 Zea mays full-length cDNA clone ZM_BFc0042P14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457484.10.0hypothetical protein SORBIDRAFT_03g008090
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0E0KU370.0A0A0E0KU37_ORYPU; Uncharacterized protein
STRINGSb03g008090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-153homeodomain GLABROUS 1